PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00054353-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 781aa    MW: 84953.4 Da    PI: 5.3232
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00054353-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.75.1e-13189249262
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       ++ kr  r+++NRe+A+ sRqRKk +i+eLeekvk++ +   +L +++  ++ e  klk++
  PSME_00054353-RA 189 EDEKRKARLMRNRESAQLSRQRKKSYIDELEEKVKSMNSTIAELNNTIAFMNAENIKLKQQ 249
                       6789*************************************99999999999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-15188252IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.634190253IPR004827Basic-leucine zipper domain
PfamPF001701.0E-10191250IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.0E-12192250No hitNo description
Gene3DG3DSA:1.20.5.1708.3E-17192250No hitNo description
CDDcd147048.67E-18193243No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006990Biological Processpositive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0009408Biological Processresponse to heat
GO:0005635Cellular Componentnuclear envelope
GO:0005654Cellular Componentnucleoplasm
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016020Cellular Componentmembrane
GO:0048471Cellular Componentperinuclear region of cytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MSSQNPLPET CSLADPMGLG MEPLTFPEEE SADLEEFLDD TLFSFPFEEE QWADCLLDDG  60
FQVDVSIPFD DFGSDYAPAF AEEAPSNPQS SDGVSATASG NGSVSGVDES NVEMISGSPP  120
PPPLPLPSSS SSSSPPSPED SSSDHSTVDD QRKRKREAED CNKHGLISSS DTTEAITNSS  180
SRSRCTGDED EKRKARLMRN RESAQLSRQR KKSYIDELEE KVKSMNSTIA ELNNTIAFMN  240
AENIKLKQQL GVLCQAPNTA NQHTVAPFPM PYPWPPYPAY PGPVMGVGNG GRVPLLPLPR  300
LKSHSQQPST PCKDRKPLKS PAAAVSSEQK PAKKRIKKVA SVVFLGFFFS IFFLLGRIGQ  360
LPDAKDLIFR ESSSRELLGN SIEELTKGGL LFKPGGGGRV LTSWDKERNF TEVTASNNHL  420
GDVHLDMELG PGRLPGSEKR NDKRNATFTD HYTDSDNDRM KMNSYIYPEN NSSTALVASL  480
FVPRNDKLVK IDGNLIIHSV LAGEEASRSL SASQSRCNKD GHVDNISLKT ESEKNSLAVR  540
TERQRALAAA AAATTDSGRN VDTSPEFLGN AAENPNYRAL ASNFRTSYRE DMESTAVDRS  600
LQQWFQEGLA GPVLSSGMCT EVFQFDASPN SPSTTANSKI VTSVASRIAN NSGGQSSNNS  660
SGSKINEAQR SAPVYPSKNR RVSYAVPLPP ARAPLKDIIE RNFTDHAEII HEERGYRRNN  720
TAPSSMVVSI LVDPRETSDD GMLSSGSLSR IFVVVLVDSV KYVTYSCVLP SKGSGSHLVT  780
R
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00345DAPTransfer from AT3G10800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1198680.0BT119868.1 Picea glauca clone GQ04111_H12 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6QTB30.0A0A0D6QTB3_ARACU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.15e-42bZIP family protein